Dataset for protein Bmf of organism Cyprinodon variegatus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q2E3E8_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Cyprinodon variegatus GN=BMF (length=163 residues).
MEEEEDDVFEPDPNSWHTPFREIKFEDRGTQTPGPGVAPHNVMLPCGVVEEPRPLFYRNAGFRLHFPAHFELVGDFDVRR
QAEHNRMEQLPLQQPAALSLEACIGQKLQIIGDQFHREHLQQIPGQPFPHLVHQHQALTLPPLPVYFSLLSPVVPLCCGG
KWH
>gnl|bcl2dbpro|A0A3Q2E3E8_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cyprinodon variegatus GN=BMF (length=157 residues).
MEEEEDDVFEPDPNSWHTPFREIKFEDRGTQTPGPGVAPHNVMLPCGVVEEPRPLFYRNAGFRLHFPAHFELVGDFDVRR
QAEHNRMEQLPLQQPAALSLEACIGQKLQIIGDQFHREHLQQYHQNQRNQGPLWWRMTAALLSLLFDRGLIGGAGWR
© 1998-2019