Dataset for protein Bad of organism Cyprinodon variegatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q2D5S0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cyprinodon variegatus GN=BAD (length=163 residues).
MAQSVETSDPIMAATFTISDSDTEPSEEVEETRNKEPRIRNSGKTHRRIRLSSESHAFTREEEARGEEEVGTPTEGYPFR
GRSNSAPPALWAAKKYGRQLRRMSDEFVTLLDKGELRKVSSTGTNRPIRHSKSWWSYLFSHQEMEGENSHHENHTQCTEQ
RGE
© 1998-2019