Dataset for protein Unclassified of organism Cynoglossus semilaevis

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A3P8UBL4_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Cynoglossus semilaevis (length=116 residues).
MRRKGEFISARAPTGRSVECQREGGRAEERKSPQSTDKRVRSLFTDSVPSSPRPVTADKATQTPSPSAQVINHALLSVAE
TQRTNGERLRQIHPEREWPLTCVCVCGFVFLYLCGR
>gnl|bcl2dbpro|A0A3P8W5W5_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Cynoglossus semilaevis (length=87 residues).
MKQEFRIKPEYTENMMNKLLFTPSLLSCPGSRICLFPLRHCCGGCNTESQLEMVCPPFQLSAFSTACPVVLPLTPLTQSR
REDSRWY
© 1998-2019