Dataset for protein Bmf of organism Cynoglossus semilaevis

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3P8UA78_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cynoglossus semilaevis GN=BMF (length=173 residues).
MDDEEDDVFEPDPHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGEEPRPLFYGNAGFRLHFPAHFELIGDRETRR
RQSDEERNRMEPRPQQQQQQQRQQQQQPVQRSVEVRIGQKLQLIGDQFHRDHLQLYHRNQRNHGPLWWRLTTTLLSLLFN
RGFFAGGGAAGRR
>gnl|bcl2dbpro|A0A3P8UA78_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Cynoglossus semilaevis GN=BMF (length=173 residues).
MDDEEDDVFEPDPHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGEEPRPLFYGNAGFRLHFPAHFELIGDRETRR
RQSDEERNRMEPRPQQQQQQQRQQQQQPVQRSVEVRIGQKLQLIGDQFHRDHLQLYHRNQRNHGPLWWRLTTTLLSLLFN
RGFFAGGGAAGRR
>gnl|bcl2dbpro|A0A3P8UA78_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Cynoglossus semilaevis GN=BMF (length=173 residues).
MDDEEDDVFEPDPHSWHTTFREIRCEDRGTQTPGPDLALNNGMLPCGVGEEPRPLFYGNAGFRLHFPAHFELIGDRETRR
RQSDEERNRMEPRPQQQQQQQRQQQQQPVQRSVEVRIGQKLQLIGDQFHRDHLQLYHRNQRNHGPLWWRLTTTLLSLLFN
RGFFAGGGAAGRR
© 1998-2019