Dataset for protein Bad of organism Cynoglossus semilaevis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3P8WIZ8_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cynoglossus semilaevis GN=BAD (length=178 residues).
MNVEVSIFPDVTMAAQFTISDSESEPEEEVEGGKIKHSLNDPEQVVPHRHNLTLPELRVAGSRRIRLNSESHASTISREE
AFQSWGEEEAGTPTEGAPFRGRSRSAPPALWAAKKYGRQLRRMSDEFDSLLDKGMRKVKSAGTARQMHHSKSWWSYLFSH
QELEGENNHHENHTHRTE
>gnl|bcl2dbpro|A0A3P8WIZ8_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cynoglossus semilaevis GN=BAD (length=166 residues).
MAAQFTISDSESEPEEEVEGGKIKHSLNDPEQVVPHRHNLTLPELRVAGSRRIRLNSESHASTISREEAFQSWGEEEAGT
PTEGAPFRGRSRSAPPALWAAKKYGRQLRRMSDEFDSLLDKGMRKVKSAGTARQMHHSKSWWSYLFSHQELEGENNHHEN
HTHRTE
© 1998-2019