Dataset for protein classical BH3-containing proteins of organism Ctenopharyngodon idella

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0P0HZF9_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ctenopharyngodon idella GN=PMAIP1 (length=45 residues).
MAKKEKTAVVECAQQLRTIGDLFDWKYKLLEIIIALQKAQTDGKR
© 1998-2018