Dataset for protein Noxa of organism Colobus angolensis palliatus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K5JY52_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K5JY52_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Colobus angolensis palliatus GN=PMAIP1 (length=124 residues).
MPGKKARKNAQPSPARAQAGTDPLGPAKTQAGRGRGRGKKLLSSPLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAET
SESDSQTLLLRNLTATKTCMRGLQKRIFLRRCTFHQFEARLHCN
© 1998-2018