Dataset for protein Bmf of organism Colobus angolensis palliatus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K5KGR6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Colobus angolensis palliatus GN=BMF (length=168 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRREQERGGPQVRLGCPLHMGHQEHRQEGHRAGLTLCLVKL
FFCCYFAF
>gnl|bcl2dbpro|A0A2K5KGR6_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Colobus angolensis palliatus GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
© 1998-2018