Dataset for protein Bik of organism Colobus angolensis palliatus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K5J4Q7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Colobus angolensis palliatus GN=BIK (length=160 residues).
MSGVRPISRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSRVSREQVLLALLLLLALLLALLSGGLHLLLK
© 1998-2018