Dataset for protein classical BH3-containing proteins of organism Chlorocebus sabaeus

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A0D9QZY8_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Chlorocebus sabaeus GN=BIK (length=159 residues).
MSGVRPISRHILMESLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLRSFIDGFTTLRENIMRFWRSLNPGSWVSREQVLLALLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|A0A0D9R491_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Chlorocebus sabaeus GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGNRPSDSGKHHHQAPGLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
GSSAPSQ
>gnl|bcl2dbpro|A0A0D9R4R5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Chlorocebus sabaeus GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRMW
WQILLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|A0A0D9RWE0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Chlorocebus sabaeus GN=BCL2L11 (length=109 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPA
DMRPEIRIAQELRRIGDEFNAYYARRLEK
>gnl|bcl2dbpro|A0A0D9S003_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Chlorocebus sabaeus GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPTRAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A0D9S2H2_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Chlorocebus sabaeus GN=BBC3 (length=199 residues).
QAPGSAMARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPALLPAAYLCAPTAPPAVTAALGG
PRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAQEIGAQLRRMADDLNAQYER
RRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A0D9SC73_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Chlorocebus sabaeus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2018