Dataset for protein Bik of organism Chlorocebus sabaeus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0D9QZY8_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Chlorocebus sabaeus GN=BIK (length=159 residues).
MSGVRPISRHILMESLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLRSFIDGFTTLRENIMRFWRSLNPGSWVSREQVLLALLLLALLLALLSGGLHLLLK
© 1998-2018