Dataset for protein Bim of organism Chlorocebus sabaeus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0D9RWE0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Chlorocebus sabaeus GN=BCL2L11 (length=109 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPA
DMRPEIRIAQELRRIGDEFNAYYARRLEK
© 1998-2018