Dataset for protein Puma of organism Chlorocebus sabaeus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0D9S2H2_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Chlorocebus sabaeus GN=BBC3 (length=199 residues).
QAPGSAMARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPALLPAAYLCAPTAPPAVTAALGG
PRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAQEIGAQLRRMADDLNAQYER
RRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
© 1998-2018