Dataset for protein Bad of organism Chlorocebus sabaeus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0D9R491_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Chlorocebus sabaeus GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGNRPSDSGKHHHQAPGLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
GSSAPSQ
© 1998-2018