Dataset for protein Hrk of organism Cercocebus atys

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K5KZ69_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Cercocebus atys GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCDCSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLSRRNL
© 1998-2018