Dataset for protein Bad of organism Cercocebus atys

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A2K5M0C1_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cercocebus atys GN=BAD (length=156 residues).
MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASHQQEQPTSSSHHGGTSSPEERGHSDADAAKL
QLDASLPVLVGSELGQGKLRPLPVTFAPRPETPPALTVLVGHLGYGRKCFPQALCKRGSVLPLSVGGLTQIPFRCM
>gnl|bcl2dbpro|A0A2K5M0C1_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cercocebus atys GN=BAD (length=163 residues).
MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASHQQEQPTSSSHHGGGAWYSPSWESEDSENPS
ARMLAEASARMSAPATDSEAQHAENVKLKALGLWRPGVATAPTPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAAS
SGG
>gnl|bcl2dbpro|A0A2K5M0C1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cercocebus atys GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSSAERGLGPSLAGDRPSDCGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
GSSAPSQ
© 1998-2018