Dataset for protein classical BH3-containing proteins of organism Cebus capucinus imitator

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A2K5PDB1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cebus capucinus imitator GN=BAD (length=167 residues).
MFQIPEFEPSEQEGSSSAERGLNPSTAGDSPPGSGKHRRQAPGLPGDASHQQGQPTSSSHHGGAGAVETRSRHRSYPAGT
EEDEGMEEEPSTFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSASWTRVIQSWWDRNLGR
GGSAPSQ
>gnl|bcl2dbpro|A0A2K5PDB1_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cebus capucinus imitator GN=BAD (length=149 residues).
MFQIPEFEPSEQEGSSSAERGLNPSTAGDSPPGSGKHRRQAPGLPGDASHQQGQPTSSSHHGENPSARMLSKTSAGMSSP
ATDSEAQHTENVKLEALGLWRPGVATDRTPQGRRRTKGWRRSPAPFGAVRARHPPTSGQHSAMAASSGG
>gnl|bcl2dbpro|A0A2K5PIE7_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Cebus capucinus imitator GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPSALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A2K5Q1Y0_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K5Q1Y0_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2L11 (length=174 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRISLPSD
>gnl|bcl2dbpro|A0A2K5QNS7_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Cebus capucinus imitator GN=BBC3 (length=131 residues).
MKCGVGSAWACPCQVPRASSSVWVPCQMCGPQPSLSLAEQHLESPVPSAPGALAGGPTQAALGVRGEEEQWAREIGAQLQ
RMADDLNAQYERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2K5QQC6_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Cebus capucinus imitator GN=PMAIP1 (length=54 residues).
MPGKKARKSAQPSPAPAPADLEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|A0A2K5QXZ1_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Cebus capucinus imitator GN=BIK (length=156 residues).
MSEERPLSIDILMETLLCEQFMDPLTMEVVGGGSDPEEDLDPVEDPLECMENSDALALQLACIADQMDVSLRARKLAQLY
EVAMYSPGLAVTLDQTDIRDVLGGIVDIFANFQEDVVRLWRSLSSGSWVSRKQAVLLAFLALLLATFSGGLHLLLK
>gnl|bcl2dbpro|A0A2K5RN49_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cebus capucinus imitator GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHQLHVQQHQQNRNRVW
WQVLLFLHNLALNGEENRNGAGLR
>gnl|bcl2dbpro|A0A2K5RN49_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Cebus capucinus imitator GN=BMF (length=130 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVAGPPLPAQPGFEWRREQEWGRPE
© 1998-2019