Dataset for protein Bmf of organism Cebus capucinus imitator

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K5RN49_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cebus capucinus imitator GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHQLHVQQHQQNRNRVW
WQVLLFLHNLALNGEENRNGAGLR
>gnl|bcl2dbpro|A0A2K5RN49_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Cebus capucinus imitator GN=BMF (length=130 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVAGPPLPAQPGFEWRREQEWGRPE
© 1998-2019