Dataset for protein Bik of organism Cebus capucinus imitator

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K5QXZ1_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Cebus capucinus imitator GN=BIK (length=156 residues).
MSEERPLSIDILMETLLCEQFMDPLTMEVVGGGSDPEEDLDPVEDPLECMENSDALALQLACIADQMDVSLRARKLAQLY
EVAMYSPGLAVTLDQTDIRDVLGGIVDIFANFQEDVVRLWRSLSSGSWVSRKQAVLLAFLALLLATFSGGLHLLLK
© 1998-2019