Dataset for protein Bim of organism Cebus capucinus imitator

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K5Q1Y0_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K5Q1Y0_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2L11 (length=174 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPTCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRISLPSD
© 1998-2019