Dataset for protein classical BH3-containing proteins of organism Cavia porcellus

[Download (right click)] [Alignment] [Repertoires]

9 sequence(s)

>gnl|bcl2dbpro|A0A286XF37_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Cavia porcellus GN=PMAIP1 (length=102 residues).
MPGKVCKSAQPNSTRAELEVECAAQLRRVGDTLNSLGCTTEALEVLAEMAGKKARKSSEPDPARARAELEVECAAQLRRI
GDKLNFQQKLMYLISKLISLVT
>gnl|bcl2dbpro|A0A286XJN2_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Cavia porcellus GN=BCL2L11 (length=196 residues).
MAKQPSDVSCECDREGGQLQPAERPSQLRAGAPTSLQTEPQGNPEGAGDRSPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAGPPHLRPEIWIAQELRRIGDEFNAS
YPRRVFLNHYQPAEDQPQMVILRLLRYIIRLVWRMH
>gnl|bcl2dbpro|A0A286XJN2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Cavia porcellus GN=BCL2L11 (length=196 residues).
MAKQPSDVSCECDREGGQLQPAERPSQLRAGAPTSLQTEPQGNPEGAGDRSPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAGPPHLRPEIWIAQELRRIGDEFNAS
YPRRVFLNHYQPAEDQPQMVILRLLRYIIRLVWRMH
>gnl|bcl2dbpro|A0A286XJN2_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Cavia porcellus GN=BCL2L11 (length=140 residues).
MAKQPSDVSCECDREGGQLQPAERPSQLRAGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAG
PPHLRPEIWIAQELRRIGDEFNASYPRRVFLNHYQPAEDQPQMVILRLLRYIIRLVWRMH
>gnl|bcl2dbpro|A0A286XXB0_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Cavia porcellus GN=BMF (length=189 residues).
VFPREMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSP
SSPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQN
RNRAWWQVLLFMHNLGLNGEENREGAGPR
>gnl|bcl2dbpro|A0A286XXB0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Cavia porcellus GN=BMF (length=236 residues).
MPGAGVFWKQYRARRRRRGPDPPRVFVTLDPGTEPWHHDSEADSLSWSHPGEMEPPQCVEELEDDVFQPEDGEPGTQPGS
LLSADLFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPA
SFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQNRNRAWWQVLLFMHNLGLNGEENREGAGPR
>gnl|bcl2dbpro|A0A286XXB0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cavia porcellus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQNRNRAW
WQVLLFMHNLGLNGEENREGAGPR
>gnl|bcl2dbpro|H0V608_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cavia porcellus GN=BAD (length=166 residues).
MFQIPEFEPSEQEDSSSEERGLGPSPTGDELGSSPAGGFLGDTSHQQRQLRSSRSHHGGTVAMETRSRHRSYPAGTEEEE
GMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATKLWQNSNWTRAIQSWWDRNLGRGGSA
PSQESV
>gnl|bcl2dbpro|H0W025_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Cavia porcellus GN=BIK (length=158 residues).
MSEAKPVARDPLMETPLFEPPPGPLLAEGALGVTQPLWAEDLSPPGDTNLMECVEGSSLVALRLACIGDEMDLRLRSPRL
AQLPGRAVHSLAITYSQMGLWGVLGRLTLSLASLRDNVWACGRPASRAWVSPRWTCRWLLPVLLLLLLLLGTLRLLLQ
© 1998-2018