Dataset for protein Bmf of organism Cavia porcellus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A286XXB0_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Cavia porcellus GN=BMF (length=189 residues).
VFPREMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSP
SSPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQN
RNRAWWQVLLFMHNLGLNGEENREGAGPR
>gnl|bcl2dbpro|A0A286XXB0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Cavia porcellus GN=BMF (length=236 residues).
MPGAGVFWKQYRARRRRRGPDPPRVFVTLDPGTEPWHHDSEADSLSWSHPGEMEPPQCVEELEDDVFQPEDGEPGTQPGS
LLSADLFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPA
SFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQNRNRAWWQVLLFMHNLGLNGEENREGAGPR
>gnl|bcl2dbpro|A0A286XXB0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Cavia porcellus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLGRLHLFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHIQQHQQNRNRAW
WQVLLFMHNLGLNGEENREGAGPR
© 1998-2018