Dataset for protein Bad of organism Cavia porcellus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|H0V608_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cavia porcellus GN=BAD (length=166 residues).
MFQIPEFEPSEQEDSSSEERGLGPSPTGDELGSSPAGGFLGDTSHQQRQLRSSRSHHGGTVAMETRSRHRSYPAGTEEEE
GMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATKLWQNSNWTRAIQSWWDRNLGRGGSA
PSQESV
© 1998-2018