Dataset for protein classical BH3-containing proteins of organism Castor canadensis

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A250YBU3_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Castor canadensis GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAQQHLESPVPSVPEALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QQHRPSPWRVLYNVIMGLLPLPRGPGAPEMEPN
>gnl|bcl2dbpro|A0A250YBU3_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Castor canadensis GN=BBC3 (length=251 residues).
MKLSVGAARACSCQVPRVASCGWAHALFVWSLARCAQSGVCPASGPVSRNLSQAPGSAMARARQEGSSPEPVEGLARDGP
RPFPLGRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSPAQQ
HLESPVPSVPEALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQQHRPSPWRVLYNVIMGLLPLP
RGPGAPEMEPN
>gnl|bcl2dbpro|A0A250YBV9_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Castor canadensis GN=BCL2L11 (length=140 residues).
MAKQPSDASSECDREGGQLQPAERPPQLRPGAPTSLQTEPPDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQVE
PMDMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQGVEDHPQMVILRLLRYIIRLVWRMH
>gnl|bcl2dbpro|A0A250YBV9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Castor canadensis GN=BCL2L11 (length=200 residues).
MAKQPSDASSECDREGGQLQPAERPPQLRPGAPTSLQTEPPGNPEGSPAGEGDRCPHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQVEPMDMRPEIWIAQELRRIGDE
FNAYYPRRVFLNNYQGVEDHPQMVILRLLRYIIRLVWRMH
© 1998-2019