Dataset for protein Unclassified of organism Carassius auratus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3G3M2I9_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Carassius auratus (length=88 residues).
MSDTSEVWFAEPSHQHVQMAAPVGAMGPEISVARELRRIGDEFNRLYCQGAGAGGNNRAQLHAPNEHAIIMWMNDLIGRV
VQFFLRRR
© 1998-2019