Dataset for protein Bim of organism Carassius auratus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3G3M2M0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Carassius auratus GN=BCL2L11 (length=181 residues).
MSDTSREQTPGNVPASRGSGESAGVGAALRPGHFDFPQPSDGDPLRGGIAMSNSHQSRSPMSRTFSRSSSGYFSVDSDSV
PGSPLLPNISEAQDDQNDEVWFAEPSHQHVQMAAPVGAMGPEISVARELRRIGDEFNRLYCQGAGAGGNNRAQLHAPNEH
AIIMWMNDLIGRVVQFFLRRR
© 1998-2019