Dataset for protein Unclassified of organism Capitella teleta

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|R7TSW1_uncBAD-01 Putative BCL2-associated agonist of cell death protein OS=[Eukaryota] Capitella teleta (length=315 residues).
MSFFLIGVSWSIRRHSLDARSTSLRTRMFMASCRQASPCPTPHDVIDSNSDENDEVNSMSDDMNDAVRNRTSQDNAVRHR
TSQSERRVGFAGVEQTEDIHFTLGGEGQEDDDLFMTSPPSQPIPIPLASGASEWSASHRLTDAFFTPPRVYMGGNLRHFS
VGSSSGFVSGDWTSEASPAAVPSTGDASLSVQVRSRDRTQSEALFGHRSSITEACSPLVNRRDRSHSAPSILTPAQRQCA
EELRRISDEFDRFYHSMDHDRDVAPGNQRPASFPRFRQRSLTAWWQNVVQVLRPSRPSPHSPIEESDPGAEDLQR
© 1998-2018