Dataset for protein classical BH3-containing proteins of organism Canis lupus familiaris

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|E2RLD4_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Canis lupus familiaris GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLALRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPRALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|F1PK10_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Canis lupus familiaris GN=BAD (length=207 residues).
TPENPSSAPAQDPGTRKSGTERREKSCALTTCCLAPTAQSMFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPSPGKHQQT
APGLLGEAGHQQGQPASRKHHGGAGAETRSRHSSFPAGTDEDEGMEEEELSPFRGRSSSAPPNLCAARRYGRELRRMSDE
FQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ
>gnl|bcl2dbpro|F1PUF4_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Canis lupus familiaris GN=BIK (length=149 residues).
MSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLVEYYDPGPSPNSNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMY
SLAFTYNQTGLRGVLRSFLDGLANLRENIRIWSFLTFRNRVSPNPGRGLVLSLLLLLVLLLGWGLRLLQ
>gnl|bcl2dbpro|J9NTK9_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Canis lupus familiaris GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|J9NWV6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|J9PB65_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=203 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPSFQLVPGISCSGAQQDCSCL
>gnl|bcl2dbpro|Q1PCT2_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Canis lupus familiaris GN=PMAIP1 (length=54 residues).
MPGRKARKSAQPGPTRAPEELEVECAIQLRKFGDKLNFRQKLLNLLSKLFRSGT
>gnl|bcl2dbpro|Q45KI9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Canis lupus familiaris GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPSPGKHQQTAPGLLGEAGHQQGQPASRKHHGGAGAETRSRHSSFPAGTD
EDEGMEEEELSPFRGRSSSAPPNLCAARRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGR
GGSAPSQ
© 1998-2018