Dataset for protein Bmf of organism Canis lupus familiaris

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|J9PB65_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Canis lupus familiaris GN=BMF (length=203 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLHLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLLEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNQNRVW
WQILLFLHNLALNADENRNGAGPSFQLVPGISCSGAQQDCSCL
© 1998-2018