Dataset for protein Bik of organism Canis lupus familiaris

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F1PUF4_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Canis lupus familiaris GN=BIK (length=149 residues).
MSHSGPLSRNLFLSTFLQEHGPEVLEVPGMTDLVEYYDPGPSPNSNNPDDVAMRLAFIGDEMEVRWMLPRVGELPGMAMY
SLAFTYNQTGLRGVLRSFLDGLANLRENIRIWSFLTFRNRVSPNPGRGLVLSLLLLLVLLLGWGLRLLQ
© 1998-2018