Dataset for protein Bim of organism Canis lupus familiaris

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|J9NWV6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Canis lupus familiaris GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
© 1998-2018