Dataset for protein Bad of organism Canis lupus familiaris

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|F1PK10_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Canis lupus familiaris GN=BAD (length=207 residues).
TPENPSSAPAQDPGTRKSGTERREKSCALTTCCLAPTAQSMFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPSPGKHQQT
APGLLGEAGHQQGQPASRKHHGGAGAETRSRHSSFPAGTDEDEGMEEEELSPFRGRSSSAPPNLCAARRYGRELRRMSDE
FQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ
>gnl|bcl2dbpro|Q45KI9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Canis lupus familiaris GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSPANRGLGPSPTGDRPPSPGKHQQTAPGLLGEAGHQQGQPASRKHHGGAGAETRSRHSSFPAGTD
EDEGMEEEELSPFRGRSSSAPPNLCAARRYGRELRRMSDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGR
GGSAPSQ
© 1998-2018