Dataset for protein classical BH3-containing proteins of organism Callithrix jacchus

[Download (right click)] [Alignment] [Repertoires]

17 sequence(s)

>gnl|bcl2dbpro|A0A2R8MW85_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Callithrix jacchus GN=BBC3 (length=131 residues).
MKCGVGSAWACPCQVPRASSSVWVPCQMCGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNALYERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN
>gnl|bcl2dbpro|F6SJL0_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Callithrix jacchus GN=BAD (length=149 residues).
MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHRRQAPGLPGDASHQQGQSTSSSHHGENPSVRMFSKASAGMSAP
ATDSEAQHTENVKLEALGLWRPGVATARTPQGRRRTKGWRRSPAPFGAVRARHPPTSGQHSAMAASSGG
>gnl|bcl2dbpro|F6SJL0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Callithrix jacchus GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHRRQAPGLPGDASHQQGQSTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVIQSWWDRNLG
RGGSAPSQ
>gnl|bcl2dbpro|F6XMC1_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|F6XMC1_BCL2L11-08 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=181 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGYRLTGQQPCLPWKVRGIGEKQEERVNPH
TWETFKSTRTHSLSARNSIHP
>gnl|bcl2dbpro|F6XMC1_BCL2L11-09 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=112 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVIRMDIGD
ISLWFRFTFTFFDLCGHHHSQGTEQQHKDFSW
>gnl|bcl2dbpro|F6XMC1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=263 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRVNWILPFCHRKEVCLEAFPVLPSKASQSAYWTTIRDRSINTCCAKAQRIISGNILQSVARWCQMMLTPQLYL
VLKDGGPVVKSALKLPWFHSPVA
>gnl|bcl2dbpro|F6XMC1_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=203 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAE
PAGMRPEIWIAQELRRIGDEFNAYYPRRVNWILPFCHRKEVCLEAFPVLPSKASQSAYWTTIRDRSINTCCAKAQRIISG
NILQSVARWCQMMLTPQLYLVLKDGGPVVKSALKLPWFHSPVA
>gnl|bcl2dbpro|F6XMC1_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=200 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRVFLNNYQAAEDHPHMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|F6XMC1_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|F6XMC1_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=174 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRISLLPD
>gnl|bcl2dbpro|F6XMC1_BCL2L11-07 BCL2-like 11 protein OS=[Eukaryota] Callithrix jacchus GN=BCL2L11 (length=171 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCLHGSPQGPLAPPASPGPFATRSPLF
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPAGMRPEIWIAQELRRIGDE
FNAYYPRRLEK
>gnl|bcl2dbpro|F7FUT7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Callithrix jacchus GN=BIK (length=155 residues).
MSEVRPLSSDIFMETLLCEQFVDPLTMEVVGGSDPEEDLDPVEDPLECMENSDALALQLACIADQMDVSLRARRLAQLYE
VAMYSPGLAFVLDRTDIGDVLSGVVDVFANFQEDIVRLWRSLSSGSWVSRKQAVLLALLALLLAMFSGGLHLLLK
>gnl|bcl2dbpro|F7GW45_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Callithrix jacchus GN=PMAIP1 (length=54 residues).
MPGKKARKSAQPSPARAPADLEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
>gnl|bcl2dbpro|F7HPK0_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Callithrix jacchus GN=BMF (length=130 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSHVVAGPPLPAQPGFEWRREQEWGRPE
>gnl|bcl2dbpro|F7HPK0_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Callithrix jacchus GN=BMF (length=184 residues).
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRMW
WQVLLFLHNLALNGEENRNGAGPR
>gnl|bcl2dbpro|U3E722_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Callithrix jacchus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2018