Dataset for protein Bik of organism Callithrix jacchus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|F7FUT7_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Callithrix jacchus GN=BIK (length=155 residues).
MSEVRPLSSDIFMETLLCEQFVDPLTMEVVGGSDPEEDLDPVEDPLECMENSDALALQLACIADQMDVSLRARRLAQLYE
VAMYSPGLAFVLDRTDIGDVLSGVVDVFANFQEDIVRLWRSLSSGSWVSRKQAVLLALLALLLAMFSGGLHLLLK
© 1998-2018