Dataset for protein Bad of organism Callithrix jacchus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|F6SJL0_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Callithrix jacchus GN=BAD (length=149 residues).
MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHRRQAPGLPGDASHQQGQSTSSSHHGENPSVRMFSKASAGMSAP
ATDSEAQHTENVKLEALGLWRPGVATARTPQGRRRTKGWRRSPAPFGAVRARHPPTSGQHSAMAASSGG
>gnl|bcl2dbpro|F6SJL0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Callithrix jacchus GN=BAD (length=168 residues).
MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHRRQAPGLPGDASHQQGQSTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWTRVIQSWWDRNLG
RGGSAPSQ
© 1998-2019