Dataset for protein Egl-1 of organism Caenorhabditis remanei

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|E3LTJ5_EGL1-01 Egg-laying defective 1 protein OS=[Eukaryota] Caenorhabditis remanei GN=egl-1 (length=114 residues).
MLTFASSSSSDLFLSMPNSHFDIVKPFCCINEKKIMCSDYCNTSSDDASTSSEFADDSGFFDDSETDDYITKTAYEIGTK
LVAMCDDFDAQMMSYSRTVPSRSILSRVFDFFAF
>gnl|bcl2dbpro|E3M1A5_EGL1-01 Egg-laying defective 1 protein OS=[Eukaryota] Caenorhabditis remanei GN=egl-1 (length=110 residues).
MLTFASSSDLLISMPSSHYDFVKPFYSNKNMLFSDFPTSSDHAVTSSEFADDSEFFDSSETSHYIHEISQEIGTKLAAMC
DDFDAKMMSYSRSGSTSRSLLGRFLDFFAF
>gnl|bcl2dbpro|E3MP30_EGL1-01 Egg-laying defective 1 protein OS=[Eukaryota] Caenorhabditis remanei GN=egl-1 (length=99 residues).
MLSLLCDFVKPFYSNNFKNMMFFDFHTSSLHAVTSSEFAEDSGFLDSSKTSHYIHERSKEIGTKLTTMCDGFDAKMMSYS
RSESTSRSLLGRFYDFFAF
© 1998-2018