Dataset for protein Unclassified of organism Caenorhabditis elegans

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|Q9TY06_uncEGL1-01 Putative Egg-laying defective 1 protein OS=[Eukaryota] Caenorhabditis elegans (length=98 residues).
MMSYKRDGYFSIVSSCLIFCLHFLPLLSIRTKLSSLFITSLANNACNSNTVEYNIGRKLTVMCDEFDSELMSYKEEKSFV
KFLGSGFKTYASIVRRVF
© 1998-2018