Dataset for protein Egl-1 of organism Caenorhabditis elegans

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|O61667_EGL1-01 Egg-laying defective 1 protein OS=[Eukaryota] Caenorhabditis elegans GN=egl-1 (length=106 residues).
MLMLTFASTSSDLLPMSNVFDVQSSVFYNEKNMFYSSSQDFSSCEDSSQFADDSGFFDDSEISSIGYEIGSKLAAMCDDF
DAQMMSYSAHASDRSLFHRLLDFFAF
© 1998-2018