Dataset for protein Unclassified of organism Caenorhabditis briggsae

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|B6IM60_uncEGL1-01 Putative Egg-laying defective 1 protein OS=[Eukaryota] Caenorhabditis briggsae (length=134 residues).
MDSRFQFSSSSSCFNRPTKLSKNVKFEFSSQEIALDRFNTTRMEPFFSIGHTIGKQLSKLCDDFDKEMMAHAHKTSIVAT
VKSLWNVMFTNFSPQEAFCFDVKNKNSRTRRHCSVIAKRCRVLFSKVFNFIIKC
© 1998-2018