Dataset for protein Unclassified of organism Caenorhabditis brenneri

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G0MQX1_uncEGL1-01 Putative Egg-laying defective 1 protein OS=[Eukaryota] Caenorhabditis brenneri (length=400 residues).
MPSTVSHSENITTVNSIYKKNMDFRPKFAFIQDSDAMTDGTSCVFVKNFGFFDDSKSNKISKRNNIGTQLTVICDNFKID
MTSSLEFSSVHNISSTVTAVSSDFGADSGFLDVSKTSSISNVGHDIGTKLAAMCDDFDDKIMSCSEFSTTNDSDVIATTP
SSALIEDSGLLDDSKTNNTGHNIGMKLAKMCDDFDDEMMAHSKFSVDYDAGVITNTKVPILVEDSGFLDDPKLGYISHNI
GVKQAVMCDNFDKEMMHHSEFVSMNDFDVMATTSSSRFGKDSGFFDDSKHSIISNIGYDIGTKVANMCDDFDAKLMSYSK
FSSIHGFNNTPMTSSSYSLDIISDYSVIDDSTSSNISDIDYVIGKQSAVLCDDSEVKTMSSTSRSLLKTVFERAWRVFGF
© 1998-2018