Dataset for protein classical BH3-containing proteins of organism Caenorhabditis brenneri

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G0NM76_EGL1-01 Egg-laying defective 1 protein OS=[Eukaryota] Caenorhabditis brenneri GN=egl-1 (length=118 residues).
MLTFASTSSDLLLPMPPSTSHFDNIVTIKPFFDKNMMLYSEFSSAQDFDGMTTTTSSDFADDSGFFDDSETSNISDIGYK
IGTQLAAMCDDFDAEMMSYSSRCRSKSLLDRILDFFIF
© 1998-2018