Dataset for protein classical BH3-containing proteins of organism Bos taurus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|F1MUT9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Bos taurus GN=BAD (length=168 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGTGAVETRSRHSSYRAGP
EDNEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLG
RGGSAPSQ
>gnl|bcl2dbpro|G3MWR6_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Bos taurus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPASGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|Q05KI3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Bos taurus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGHAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQYQQNRNRMW
WQILLFLHNVALNGDENRNGAGPR
>gnl|bcl2dbpro|Q2YDF0_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Bos taurus GN=BCL2L11 (length=139 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ
>gnl|bcl2dbpro|Q3SYZ0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Bos taurus GN=BAD (length=168 residues).
MFQIPEFEQSEQEDSSRADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGTGAVETRSRHSSYRAGP
EDNEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATEMRQSPSWTRFLQSWLSRNLG
RGGSAPSQ
© 1998-2018