Dataset for protein Puma of organism Bos taurus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q1LXZ6_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Bos taurus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGAPRWPGG
PRSRPRGPRPDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEER
QRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
© 1998-2019