Dataset for protein Bad of organism Bos taurus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|F1MUT9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Bos taurus GN=BAD (length=168 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGTGAVETRSRHSSYRAGP
EDNEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLG
RGGSAPSQ
>gnl|bcl2dbpro|Q3SYZ0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Bos taurus GN=BAD (length=168 residues).
MFQIPEFEQSEQEDSSRADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSHHGGTGAVETRSRHSSYRAGP
EDNEETEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHVSFKGLPRPKSAGTATEMRQSPSWTRFLQSWLSRNLG
RGGSAPSQ
© 1998-2018