Dataset for protein classical BH3-containing proteins of organism Astyanax mexicanus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A3B1IH05_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Astyanax mexicanus GN=BAD (length=179 residues).
MSTAARAAAGTCDSTAVSQPSKLDFTMDHMFTISDESDASEELGDSDQPEVSKTAEPSRSGQHITVPEKLRVEPRQRNFS
MNEEALQESGAGRHEDGARDGDSFRRRSRSAPPSLWAAKKYGRQLRKMSDEFDKGLEQGMKRVRSAGAARQMQNSPSWFA
FLWSHKESDSEASSSRPAE
>gnl|bcl2dbpro|A0A3B1JLM2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Astyanax mexicanus GN=BAD (length=213 residues).
MSNQYLLKLRRARFNCDEEGYSQALNSRTSTEGGGRDTLFRPLCWNSSGSTVFTMEKTPPHSKEDDISPIDDHDESRWSE
AVKSVDSPQTDSGPSMYRDTSSDELLEVGGRVRLYSESQVYNINRWEDNENQDGASAEDGGVGDGAPFRGRSQSAPAALW
KAKKYGRQLRRMSDEFDTWLDKGDLRRTTGPGRHTNRGWFSFLWGTKEEEGRE
>gnl|bcl2dbpro|A0A3B1JXK6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Astyanax mexicanus GN=BCL2L11 (length=203 residues).
MSRPSNRATRPPFLKEQGERGQSGGGGGTLSRAEQCEQPEPGDGDPVRGPPALHNSLLGYQTRSPLFRTLSRSSSGYFSF
DSEPSSPLLMHSASTQTPSPSSQVIIHALQRISEARGDAQSFELCPGPNHCPPHRAAAAGDMQAHWYIAQELRRIGDEFN
DLYFRGAGRNGGGAQLPAQNEPAFILWMGLLIERLRQFLHRRR
>gnl|bcl2dbpro|A0A3B1K1X5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Astyanax mexicanus GN=BMF (length=155 residues).
MDDEEDDVFVTDPEPWRSPISVIKQEERGTQTPGRPPARTNGMLPCGISEEPRRLFYGSAGLLLLAPSARSERVGDAMFR
EEHRAVEPRRRPAHSVEARIGQKLQMIGDQFYQEHMLQHRNQRNQQPLWLRLASALYTLLFEREPAAHGRREDRR
© 1998-2019