Dataset for protein classical BH3-containing proteins of organism Astyanax mexicanus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|W5KIV3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Astyanax mexicanus GN=BAD (length=105 residues).
GGRVRLYSESQVYNINRWEDNENQDGASAEDGGVGDGAPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGDLRRT
TGPGRHTNRGWFSFLWGTKEEEGRE
>gnl|bcl2dbpro|W5KM88_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Astyanax mexicanus GN=BMF (length=199 residues).
MCAFVFVYTFSGQECPDVGKAKSYLFWTSNVGTKLRWGAWKALLMDDEEDDVFVTDPEPWRSPISVIKQEERGTQTPGRP
PARTNGMLPCGISEEPRRLFYGSAGLLLLAPSARSERVGDAMFREEHRAVEPRRRPAHSVEARIGQKLQMIGDQFYQEHM
LQHRNQRNQQPLWLRLASALYTLLFEREPAAHGRREDRR
>gnl|bcl2dbpro|W5KW69_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Astyanax mexicanus GN=BAD (length=155 residues).
MDHMFTISDESDASEELGDSDQPEVSKTAEPSRSGQHITVPEKLRGESVSRQRNFSMNEEDLQESGAGRHEDGARDGDSF
RRRSRSAPPSLWAAKKYGRQLRKMSDEFDKGLEQGMKRVRSAGAARQMQNSPSWFAFLWSHKESDSEASSSRPAE
© 1998-2018