Dataset for protein Bmf of organism Astyanax mexicanus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|W5KM88_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Astyanax mexicanus GN=BMF (length=199 residues).
MCAFVFVYTFSGQECPDVGKAKSYLFWTSNVGTKLRWGAWKALLMDDEEDDVFVTDPEPWRSPISVIKQEERGTQTPGRP
PARTNGMLPCGISEEPRRLFYGSAGLLLLAPSARSERVGDAMFREEHRAVEPRRRPAHSVEARIGQKLQMIGDQFYQEHM
LQHRNQRNQQPLWLRLASALYTLLFEREPAAHGRREDRR
© 1998-2018