Dataset for protein Bmf of organism Astatotilapia calliptera

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3P8NFE2_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Astatotilapia calliptera GN=BMF (length=170 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRASR
QGSTEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLVKASRIQTCWLETAEAYATPCKVHHSVITVWKPRG
LSQWQFLTVN
>gnl|bcl2dbpro|A0A3P8NFE2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Astatotilapia calliptera GN=BMF (length=163 residues).
MDDEEDDVFEPKANCWRTTFREIKCEHRGTQTPGPALVPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELVGDHRASR
QGSTEQQNSMERLPRQRPAARSVEACIGQKLQLIGDQFHWERLQLYHRNQRNQGPMWWRLAAAILSLLFDRGFIAGGGGG
GRR
© 1998-2019