Dataset for protein Bad of organism Astatotilapia calliptera

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3P8QRJ7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Astatotilapia calliptera GN=BAD (length=158 residues).
MAANFKISDSDSEASEEVGEGENQQSAGQAQESKPQTLSLPVTKTTAAGRLRVNSESHTSSIARDEELMARGEDEVCTPT
EGDPFRRRSKSAPPALWAAKKYGRQLRRMSDEFDSLLDKGEMKVKKLHHSKTWWSYLFSHQETEGENNHLENHNQRTE
© 1998-2019