Dataset for protein Puma of organism Aotus nancymaae

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K5F6X4_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Aotus nancymaae GN=BBC3 (length=130 residues).
KCGVGSAWACPCQVPRASSSTWVPCQMCGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRR
MADDLNAQYERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN
© 1998-2018