Dataset for protein classical BH3-containing proteins of organism Anolis carolinensis

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|H9GL49_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Anolis carolinensis GN=BMF (length=222 residues).
MDPPGYLDDDFSTLDGLEDDVFHAEDCGLASQPSEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRQARQQDKATQT
LNPSSSSQDVMLPCGVTEEPQRLFYGNAGYRLHVSPIGFSLNPHFQEEPQESPQELRTEVQIARKLQCIADQFHRLHLQR
HQQNRNQVWWQIFFFLHNVALNMEANRHRAGRSCTTTYFPFTEPPVCFPFSEMLPRFCLEAI
>gnl|bcl2dbpro|R4G9R5_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Anolis carolinensis GN=BCL2L11 (length=116 residues).
MLVVGSSQPQLCLLPKQLNVLSANAFAISCFLYRDVPWRRTGRRWCEAETSRWQSRPIPEDMQPEIWIAQELRRIGDEFN
ASHCPRRGFLDYQAVNHQIIILRLLHYIVRFIWRMQ
© 1998-2018